PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_9023F3504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 319aa    MW: 35301.3 Da    PI: 4.5155
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_9023F3504.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-182269148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT eEd llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Traes_4DL_9023F3504.1 22 RGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 69
                           89********************************************97 PP

2Myb_DNA-binding51.32.6e-1675118146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Traes_4DL_9023F3504.1  75 RGSITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                            7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0761769IPR017930Myb domain
SuperFamilySSF466898.2E-3120116IPR009057Homeodomain-like
SMARTSM007172.1E-152171IPR001005SANT/Myb domain
PfamPF002491.3E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-222376IPR009057Homeodomain-like
CDDcd001677.92E-122469No hitNo description
PROSITE profilePS5129423.61770124IPR017930Myb domain
SMARTSM007178.1E-1574122IPR001005SANT/Myb domain
PfamPF002492.3E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2377123IPR009057Homeodomain-like
CDDcd001672.67E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDMVHERDSS SEEEVMAGDL RRGPWTVEED ILLVNYIAAH GEGRWNSLAR SAGLKRTGKS  60
CRLRWLNYLR PDLRRGSITP QEQLLILELH SRWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKHAKQLKCD VNSQQFKDVM RYLWMPRLVE RIQAAATADA VQTAADTPLS WQHGADDALY  180
ESPELPVDAC WPAEYAAVAG GQLPDASVAE LSSTTTAGSS SPSTTDSGAG AQPSWPAAVD  240
GAEWFTTACD ASSAAATMCD TDQLIQQQAP SQLAGTWTSE PLPSLGFPEL GVADFEIGSF  300
DVDSIWSMDD LWYTQPQFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251312218126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519090.0JF951909.1 Triticum aestivum clone TaMYB26 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649985.11e-167PREDICTED: transcription factor WER-like
TrEMBLW5EJP20.0W5EJP2_WHEAT; Uncharacterized protein
STRINGOB03G25040.11e-167(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-83myb domain protein 112
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]